GenomeNet

>syn:slr0624 K01791 UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing) [EC:5.1.3.14] | (GenBank) hypothetical protein (A)
MPVSPLSVCITLGTRPEAIKLAPVIRAFLAQPDMHTQVLLTGQHREMVQQVMDLFALSAD
ADLEIMQPGQTLTDITQGCLEGLGQLWQEKPPQLVIVQGDTTTAFAAALAAFYQQIPIGH
VEAGLRTDNLFNPYPEEANRRLISQIAQLHFAPTTLAVENLRRSDVTGEIHLTGNTVIDA
LLTVAEQKPACPIPGLDWQKHRVLLATVHRRENWGEPLQDILTSFSQILEQFPDTALLLP
MHRNPTVREPIQKALGNHPRVFLTEPLDYAQLVGAIQHCYLLLTDSGGLQEEAPSLGKPV
LVLRETTERPEAIAAGTAKLVGTDPAAVTKAAGELLSQPQAYEQMANAINPFGDGTASQK
IIEIVRNYFQH

BLAST