GenomeNet

>syn:slr0883 K01005 polyisoprenyl-teichoic acid--peptidoglycan teichoic acid transferase [EC:2.7.8.-] | (GenBank) psr; regulation of penicillin binding protein 5 production (A)
MANSTESGSLQSSSTVKVRSHYRPNNGTGSPGGRPRPKRGFLPLGKGLVWGGLVTLTATV
AAIAGVGIGFFTPGPKGLVQQVIPGQSAGVEAGQADLFPYHISRPVNILVMGIDRVEPTE
EEPNVDEFGGRSDTMLLVRFDPRENGLKLLSIPRDTRVFIPDVGYTKINDANAYGGPQLA
ARVINRNLGEVPIDRYVRVTTDALQELVDLVGGVEVFVPRPMFYEDKTQQLLIDLPAGLQ
TLNGQQAEQFVRFRYDANGDIGRVQRQETLLKALQNRLSHPSMITRIPKAIGIMQKTVDT
NLTMEEILALVNFGRQLDRQEVQMVMLPGRFSQPAEFDGRSYWVMSDVGKRQVLRNYFDV
IEEVPTWAETPGRSPESLRIALQNATDDPQALERVKEYLQSKDFRNFYETSESPQLLAET
KILVQRGDLDGAHYLRQTLGGGVVEASSVGDLGSDLTIQVGMDLDQWLKESTPVDDSTPQ
F

BLAST