GenomeNet

>syn:slr0909 no KO assigned | (GenBank) unknown protein (A)
MIKQLLKNNRIVQRIKVLKDLFLQKLDDLQASVDQIKITTDQNLEEIRLELEQKNRNINQ
ILENQIFLIKSALDTARTIKYLVESGQQRQIIVEQMINAIHQEFQRIREESERSNGYIHQ
EFQNIRSESQQRYQLLHQEFQAVLGNLQHYQEILIDKFLDLQENSQQQDVFLRETLAQIA
ADVHDQKFKVVTDPSYFQAIDIELMVYLYSYLPHRRTIDVGANRGDVSARLLQTGYEVYA
FEPFPPVLAKLQERLGQNSNFHALGYALGSANETRNLHLVVDQTEDKIFDDATFYSSLTR
HSLTEGLVFHDSITVEVKTIASLHEAGTLPDDIGLVKIDTEGFDLEVIKGMGNFRYPVVL
AEFWDPTFPFGQTGAMNHLVDMVPAMRQRDYRWHIIIYRIWGQHEVSYYCNSDYSLENSW
GNVFFFQDYEIFSQALKWCNSVMPATYFAA

BLAST