GenomeNet

>syn:slr0949 K11956 neutral amino acid transport system permease protein | (GenBank) livH; high-affinity branched-chain amino acid transport permease protein (A)
MDLSQLIFNGIAVGSIIALGAVGLTLTYGILRLSNFAHGDFMTLAAYLTWWANTSGINLW
LSMALGCVGTIIAMFIGEWLLWKPMRARRATATTLIIISIGLALFLRNGILLIWGGNNQN
YRVPIVPAQDFMGIKFEYYRLLVIAMAIAAMVVLHLILQRTKVGKAMRAVADNVDLAKVS
GINVEWVVMWTWVMTAVLTALGGSMYGLMTTLKPNMGWFLILPMFASVILGGIGNPYGAI
AGGIIIGVAQEVSVPWFGTSYKMGVALLLMIIILFIRPQGLFKGTQ

BLAST