GenomeNet

>syn:slr1220 no KO assigned | (GenBank) unknown protein (A)
MTIDNIRLRNEFINTEVITRSSGKKLGVVKEVLVDVDQREIVALGLRDNFLSLTGMPQYL
YLNSIVQTGDVVLVENDDVFELVEVDLYSPLVNSEVVTETGEPLGRVRDFQFDLATGKVS
SIIIASLGLPQIPDQLISTYELSIDEVVSSGPNRLIVFEGAEERLNQLSVGLLERLGIGR
PSWERMEEDLYYPPTTRPENQLGSGIPVRPPVQVRQPEPVLEERWNEDDWQDTRPAPPPR
REVAPLRYPEPEYEDDYEVDNWGEASSRSSAPEPDYDYEDGVAGDVWDDDEAPAPYSPPR
VNIPETRREKMPEYYEE

BLAST