GenomeNet

>syn:slr1234 K02503 histidine triad (HIT) family protein | (GenBank) protein kinase C inhibitor (A)
MAEDTIFSKIIRREIPAAIVYEDDLCLAFKDVNPQAPVHVLLIPKKPLPQLSAATPEDHA
LLGHLLLKAKEVAADLGIGDQFRLVINNGAEVGQTVFHLHLHILGGRPFSWPPG

BLAST