GenomeNet

>syn:slr1239 K00324 H+-translocating NAD(P) transhydrogenase subunit alpha [EC:1.6.1.2 7.1.1.1] | (GenBank) pntA; pyridine nucleotide transhydrogenase alpha subunit (A)
MTIAAPKTTVAPEMKPTTPKKIGVPRESFDQECRVAMTPDTAQKLQKLGFDLLLETGAGA
KADFADRLYESLGCGIVDGRQTLFEQADIILKVRPPSPAEVEELPAGKALISFIWPAQNP
ELLEKLAAKNITVLAMDAVPRISRAQKLDALSSMANIAGYRAIIEAANRFGRFFTGQITA
AGKVPPAKVLVIGAGVAGLAAIGAAKSLGAIVRAFDTRPVVKEQVESLGGEFLLLDFKED
GTGQGGYAKVMSEEFIAAEMALFAAQAKEVDIIITTALIPGRPAPKLITEPMVKSMRAGS
VVVDLAAEQGGNCEVTKPGEVYEYEGVTIIGYTDLPSRMASQSSQLYGTNLWHLLKDMGG
SEAFKVDVEDEVIRGALVSHEGKITWPPPKLNPPSPVQPAKPTVTVVESEAKSAKKSGSG
NFLWLALAAIALVGIGIGAPTSFLSHFTVFVLACVVGWQLIWNVAPALHTPLMSVTNAIS
GIIIIGGMLQISGPLNSPTTILGAIAILVGTINIAGGFLVTQRMLKMFRK

BLAST