GenomeNet

>syn:slr1241 K07075 uncharacterized protein | (GenBank) hypothetical protein (A)
MQISPAFKYKVSIDPGKITAFCQQWQITELALFGSFLRDDFDLDNSDIDVLVSFEPNVPW
TILDLVDMEDQLQQIFGRKVDLMERLSIEQSQNPLRKKAILESLQVIYTESRLQI

BLAST