GenomeNet

>syn:slr1356 K02945 small subunit ribosomal protein S1 | (GenBank) rps1; 30S ribosomal protein S1 (A)
MVSQTSTATIGFTLEDFAALLDKYDYHFSPGDIVAGTVFSMESRGALIDIGAKTAAYIPI
QEMSINRVDDPEEVLQPNETREFFILTDENEDGQLTLSIRRIEYMRAWERVRQLQAEDAT
VRSNVFATNRGGALVRIEGLRGFIPGSHISAREAKEDLVGEDLPLKFLEVDEERNRLVLS
HRRALVERKMNGLEVAQVVVGSVRGIKPYGAFIDIGGVSGLLHISEISHDHIDTPHSVFN
VNDEIKVMIIDLDAERGRISLSTKQLEPEPGAMLKDRDLVNEMADEMAEIFRQKRLAEAQ
GIPYEPPTSVDDTDDEEDESLAVSAVDE

BLAST