GenomeNet

>syn:slr1409 no KO assigned | (GenBank) beta transducin-like protein (A)
MRIFPVFLLTFSLFLIKEEIVTAEVKVSAPVVNQSGIKLNLERQFTGSDVAINRIHFSPD
GQFLLTAAADGVGTLWTKEGEMLGQLQGQKPPMFNARLSPDRQILITTGYDGTIRLWNLQ
GELLEEQQPHRAAVADAIFSPDSQIIVTCSDDGQTKIFTRQGQEIASVLKSGTARNLAYH
PQGLLIASVSDSGSLHLINPNGKIEREISTGQGRINNVNFSPNGEQLLTSGINGSAKLWN
LAGELIHEYKVVPTGWVNSAQFYPKGEWLATASDDGTIRFWQKDGQLIYELPLVNARLTS
LSFSPDGKQLAATSSQGQVWVFNLSY

BLAST