GenomeNet

>syn:slr1443 K08884 serine/threonine protein kinase, bacterial [EC:2.7.11.1] | (GenBank) pknA; protein kinase (A)
MTPSLSLGQRLDDRYLIQLHLGQNSLGQQYLAQDTHRFDEPCTITVLTAPPGDKAGNLFK
QQAEILYALDHPQIANFREFFALGSELYLVQDFIEGQSYFDLLKDRRLQGKAFTELEVRQ
WCRQLLPVLHYLHIQKICHGQISPSSIMRRTVDGLPVLVDFTHSQYYSGTPGEDRRDLHG
LGLGAIALLTGEVNPNPPWENLLSSVALSQEFRQLLLKLLAWPPLVDWPTLTDNLNNLPQ
HFLPTVAEFNLTSTIPEQTDNGVGKSSTGEPPFPTVHQSPESSSSAKVKNMVRVDGLKGL
VKKSFILLGLMAIAMALGWGAGQLWLDNQQRAALEKLAQEEPGDDVPEKTDLEIKNEIRA
RRLNLGISPQRFQTLMDDGLAFQLGIDPQQRLEKNPNTNGAPLSLGSPEQQMAMTITVLD
ALESLSREATRDFAQNNSGDRRRWIPRVNQLRLSSRSFYDLVNARFHHYLPMVSPALLGE
PEFEQRPLAQVWNAMAFDSLASLEDESHYQRLSFDDTNQLNLNGTLEPGEGYAYAVTIPP
TEEFSLQLTAPPTARISFYPPTGPEVILQNSAMHRWSGPTDQAGYYELVITSVAEEPIAF
ELELSIIPASAQPF

BLAST