GenomeNet

>syn:slr1538 K02188 cobalt-precorrin-5B (C1)-methyltransferase [EC:2.1.1.195] | (GenBank) cbiD; CbiD protein (A)
MFACASAIAAVETLLTSNCPDSVTLELLEPARTAEIAIEQGALLGHHRALAITRSEPGNN
LDLTRHTPVWAEVEFTPGEGKLIIQGGEGIGKQLDREGQAAIYSYAQRLLRHHLQPYISG
DQTLMVSLILPLGRTLATRTSNAAFGVVEGLSLLGTSGIAQPLSAPEQLAEFQQHLTSAA
QQHQCLVFCLGENGLDLARQWGVPLDQMVKTANWLGSLFVAAAAVGVQEILLLGYHGKLI
KLAGGIFHTHHHLADGRLEILTAQAVQAGLPYPLVQELGQAPTTEAGLKLLRHWQTEQNC
PWVSKIYQAMADTVDRRSEEYVYKVSQHQLKVGSLLFDGDRQPVAISTQGQAMADKLGMT
IPET

BLAST