GenomeNet

>syn:slr1540 no KO assigned | (GenBank) hypothetical protein (A)
MRILIMGGTRFIGIHLCRVLVAQGHEVVLFNRGNRPDPVNGVAQIHGDRRVAEQLREKLE
KEEFDVIFDNNGRELSDTQPLVDLYNGRVQQFVYMSSAGVYQASSQMPHRETDAVDPQSR
HKGKFETERYLAQSGIPWTAIRPTYIYGPHNYNALESWFFDRLVRGRAIPIPGNGQYITQ
LGHVEDLAIAMAKTIVTPAAIGQIYNISGDRYVTMNGLAQACATAAGLDPQGVKLVHYDP
KDFDFGKRKAFPLRQQHFFADIQKAQDHLDWHPNYGLVEGLKNSFQLDYLPSGKGEEKGD
FDLDEQILAFS

BLAST