GenomeNet

>syn:slr1543 no KO assigned | (GenBank) DNA-damage-inducible protein (A)
MNFDRIFAWPLTSLEVFMNLALPSQYQFLPRFFRLATIAVLSNMMVPLAGLVDTAFLGHL
EDIDYLAGVILGSILFDYLYRVLKFLRTSTTALTAQAVGEEDQAEVWVAGLRSALVALLL
GLGILALQYPLQKFGFALLTGAPGVEQSGMDYFYGRIWGAPAVLLNFVILGWLLGQERNG
LVLLISLVANFSNVGLDYLMINRWGWASAGAGWATASSQYLALALGLISIVVLAQGEKEK
GEFKAAIAKLSDWGALRATIALKGNILIRFVILITTYSLFTNISSSFGTEVLAQNGLLLQ
IALLSQFTIQGVGMTSQTLTGNFKSKGEYQLLLPVLLTAIVTTLLMALGFAAVAIAFPET
LFGLLTNHAEINDSVRQYTIWLIPLLESTALAFMLEAYFIGLKASQPLRNGVLFAFFGIY
LPCLGLAIWQQSNNLLWFSLVSYMLGLVVYLGWQLLTRFSPQTLALESKQPS

BLAST