GenomeNet

>syn:slr1748 K02226 alpha-ribazole phosphatase [EC:3.1.3.73] | (GenBank) hypothetical protein (A)
MALKLYFLRHAQTAYSATGGYCGTPENDPGLTPEGILMAKEFAEAYAQHPWQAVYVSPLQ
RARQTVQPLCDRLGIEMQIRPGLREVAYGEWEGLHPDEVYQRDHDLYMQWLTDPAWNSPP
GGERGIDIARRGTRVLEEIEDRFDDGNVLLVSHKATIRILLCCLLGIDVGRYRDRFAMPV
TGLSVVELSSRGPLFHCIAERSHLSPYLRSLPST

BLAST