GenomeNet

>syn:slr1878 K02288 phycocyanobilin lyase subunit alpha [EC:4.4.1.32] | (GenBank) cpcE; phycocyanin alpha phycocyanobilin lyase; CpcE (A)
MSEPNLNPAYTLDQAIANLQQTEDASARYYAAWWIGRFRAAQPETIAALLVALEDETDRS
PDGGYPLRRNAAKALGKLGDRQVVPALIKALECEDYYVRESAAQALEGLGDARAMAPLMA
KLTGGLAAAQLVEGKPHLAQPYEAIIEALGTLQAVESIGLIEPFLEHFSPKVQYAAARAL
FQLTGDNRYGDLLITALGGTDLQLRRSAMMDLGATGYLPGAQAIAKAFAENSLKLIALRD
LWATHRQRQASSESKALSPASRQILELMDSLL

BLAST