GenomeNet

>syn:slr2135 K03192 urease accessory protein | (GenBank) hupE; hydrogenase accessory protein (A)
MLGLGTKFSWFHWVTASGGNGEKLVQSQYCPATVMGPGPKSGCPPTMADSVNQICEVQVV
NVTGLSNLLTFPRLLAHHPFGGHTPSNFLEGFLSGLGHPVIGLDHLAFVIAIGLIAAGLR
YGWLMPLIFVATAITGTGLHLIGANLPQPELVIAGSVLLFGIFLALGRPLPSPLVMGLAA
VAGMFHGYAYGEAIVGAQMNPVAAYLLGFSFIQLAIAMGVYALAKGWYETKETLLNLRFI
GFLLTGVGLAFTSGALLG

BLAST