GenomeNet

>syn:ssr2049 no KO assigned | (GenBank) bchB; protochlorophillide reductase 57 kD subunit (A)
MLWHVFYGRGRMLLSNHAQGRNFRPIFVMSDPISWTAEATERLKEIPFFVRPAARKKIEN
FAREAGITEITETVYEQAKQKFN

BLAST