GenomeNet

>syn:ssr2062 no KO assigned | (GenBank) unknown protein (A)
MKTANFITSSCRYCRYYQAEGRRGGTCSQLNVPVQGQWKACALAAKPFAGPWENLEDVVY
LEHAYALTSKDALVEQSAETIATAAEAA

BLAST