GenomeNet

>syn:ssr2422 no KO assigned | (GenBank) unknown protein (A)
MTNNDNIRLEQISEDLEAQRHSLNEQGQRLDRIETILTNLVTEIKIYDSKLDTYQKASQQ
IVNIAFGLLATSALAIIIPAVLNR

BLAST