GenomeNet

>syn:ssr2611 no KO assigned | (GenBank) unknown protein (A)
MTPKSGILLLLSCVSAIAAVGCVFELSSGQPELGSTTTTAILLGSIPLTALFFWIAVQDT
RANMK

BLAST