GenomeNet

>tak:Tharo_3128 K00563 23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187] | (GenBank) Ribosomal RNA large subunit methyltransferase A (A)
MITPFQALACPLDGEPLQRDGAAWRCAAGHSFDIARQGYTNLLPVQHKRSRDPGDSKEMV
AARHRFLDPGSGTGTEPCPPGPYQPLAAAVSRALLAGLAPGAAASCLDAGCGEGYYLRQL
AAAAGERHPLALLGLDISKWAVMAAAKQDKRANWVVGSNAGLPVQTGTLDRVLCMFGFPV
HAEFARVLRPGGELLLVDAGPDHLRELREIIYPALKPERPANPRAPDGFAALPAETVRYR
LELAGAAQIADLLAMTPHLYRASAAGRARAAALDALTVTVDVRLARFRRITASTAATSAG
TCAEAPTRASESR

BLAST