GenomeNet

>tau:Tola_2439 no KO assigned | (GenBank) conserved hypothetical protein (A)
MSEHQHIRADGTVMFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWLFSTI
AIAPTFIVLGIAFGVFIGGGILRRQKRGRPDTWLYRQLQWRIATRYPLMAGWIGGHALIT
RSGRWSNRRVAR

BLAST