GenomeNet

>thas:C6Y53_05175 K02433 aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7] | (GenBank) amidase (A)
MAALPLFIWMGEILYRHLDRATDHLRADTMTQTPQSLLDAARAKAAAPDFTSVFDDPVSQ
HGPLSGLTVAVKDLFDVRGHVTRAGTVVRKTAAPAVADAEAVARLRAAGAGLIGHANMTE
YAYSGLGLNPHYGTPLTPLCKGCIAGGSTSGGASAVARGVADIALGTDTGGSSRIPAAFC
GLFGFKPTARSIPRDGAVPLSQSLDSVGVMTRDAGLLRPVLNVLRDADLPPAPMPRGVIV
PENFGMDELDAEVADAFETALAALRDAGVAVRRLSLDIFDRYRALPVWHFSAVESRANHG
RDYDEARGDLDPRVAARMARADGVSGIDYARTLDMRAGLIREAGRLFDQMPLALPSVAIM
PPRLDALQDDATFDRINLLALRNTSFGNVIDGCSVSIPVTSHPGAGLMLTAAPGRDAMLV
AMAETLGSL

BLAST