GenomeNet

>tps:THAPSDRAFT_6290 K00940 nucleoside-diphosphate kinase [EC:2.7.4.6] | (RefSeq) NDK2; nucleoside diphosphate kinase (A)
MNASERTYIMIKPDGVQRGIVGNIISRFETKGYKLVALKTKQATKELLDTHYCDLVEKPF
FPKLRDYMMSGPVVSMIWEGKEAVATGRKMLGATNPLASEPGTIRGDFCIEVGRNICHGS
DSVENAEKEIALWFEESELLDWESHSKDWIYE

BLAST