GenomeNet

>tto:Thethe_00094 K01874 methionyl-tRNA synthetase [EC:6.1.1.10] | (GenBank) protein containing C-terminal region/beta chain of methionyl-tRNA synthetase (A)
MAKTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVMFLTGTDEHGQKIQRKA
KEKGVTPKQYVDEIVAWIKDLWKTMDISNDKFIRTTDKQHEEIVQKIFTKLYEKGDIYKS
EYEGWYCTPCETFWTEKQLVDGNCPDCGRPVELVKEESYFFKLSNYADKLLKYYEEHPDF
IQPESRLNEMVSFIKSGLEDLCVSRTSFDWGVKVPFDPKHVVYVWIDALSNYITALGYST
DHDEDFKKYWPADVHLVGKEIVRFHTIIWPAMLMALDLPLPKKVFGHGWLILEGGKMSKS
KGNVVDPKELVSKYGVDAIRYFLLREVPFGADGVFSNEALISRINSDLANDFGNLLSRTV
TMVEKYFDGVVPEVSDKDDVDDELISIANNLPKVVESYMDKLQFSNALAEIWKLVGRANK
YIDETMPWVLAKDESKKGRLKTVLYNLVESLRFVAILITPFMPNTPMKIYEQLGIGDDLR
TWDSLKFGLLKSGTKVKRGENIFPRIDVEKELKEAEKESPKKAEVKEEANYIKIDDFAKI
DLRVAEVLEAEKVEGADKLLKLKLKVGDEVRQVVSGLALHYKSDELVGKKLVLVANLEPK
KLRGIESYGMILAASNEGKLTVVTVDKDIESGAKVK

BLAST