GenomeNet

>vbh:CMV30_18120 K09690 lipopolysaccharide transport system permease protein | (GenBank) phosphate ABC transporter permease (A)
MGFVRHPRPRRHIFLFAFPRPPRLPPLRVNPLPATPVAPPAVAASASERSAPLVIEAGRA
DLHYWRDLWRYRELAVLLAWRDIQVRYKQAVLGITWALIQPAVQTVLLWFVFGKLAKMPA
GDESIPYPFLVLSGLLPWQLFSAAFNNAGNSLVGNSHLISKVYFPRLIMPLSALAVALLD
MLILLALTLPVMAAFDVWPTWRLLLLPLFTLGTLLIALGAGLWITALTVKFRDFRFIAPF
ILQIGMFVTPVGYRTDLLPNWRDLLALNPLTSMVEGFRWCLLGGRTQFDPSGLAISLPIT
ALLLITGLWYFRKTERHFSDVI

BLAST