GenomeNet

>vei:Veis_1626 K07053 3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97] | (GenBank) PHP C-terminal domain protein (A)
MPIPATIPLNADLHCHSVVSDGTLSPEDLAARARANGVQLWALTDHDETGGLRRAGAAAQ
AQGMAYLTGVEISVTFADTTVHIVGLGFDPDNAQLAQGLAATRDGRGERAKEMGAQLARA
GIGGAYEGALQFVGNPALISRMHFARFLVESGRCQDTGEVFRKYLTEGRPGYVPHRWARL
GDAVRWITEAEGVAVIAHPARYKFSANEEFALFSEFKAHGGQAVEVVTGSHSAAEYLSYA
ALAQEFGLAASRGSDFHSPAESHTDLGSLPPLPDALTPVWTLLADRIRHPARHLVPHWAP
DRA

BLAST