GenomeNet

>vpe:Varpa_3270 K11891 type VI secretion system protein ImpL | (GenBank) type VI secretion protein IcmF (A)
MQYLKQFLAFLFSRQMLAFVAMVLLALAIWFVGPLLAVDGLRPLASVGVRVAFIVLLLVL
GILWLVSGPYSLVGVAALCLLLWHAGPLLDIGAVKPLASVGVRVAIIGAILLLYALSWLY
RFWQALRNNEDLLAKVLSFGKDAGKDETAKEEIKTVTAAVHRALAQLKGLRGRGGLRRLF
EGNRYLYELPWYMVIGSAGAGKTTALLNAGLQFPLARQMGNASKRVVFKSEGGTLHCDWW
FANEAVFIDTAGRYTTQERNPATDPVEWRAFLGLLRKHRTRAPLNGVIVALDAGEMLTMT
EMERAEHASLVHDRLTDLRQELGIRFPVYVVVTKMDLLRGFSEYFQSLTSEGRMQAWGFA
LPFHGIKNTRAGTQARDSLRTQMDKELALLNDRLAEGLRARLNEEFDVERRKRLFALPKE
LAALAVPLVPMLDQIFLVSRFDRTQLHDTLRGVYFTSGAQAHAEVPADHQTLVQRLQSSL
GPSSSSGLQAAGTSPEQGQQGFFLQELLTKVIIPEAHLVRPNLRWEFRFRLLRLMGHALA
LVIFIWLAGALAVSFGNNRRYLDTVSQRTDVLAGQVSALFGSFKPSGVPDVLNGARELPG
YAGLDIDSPPGSFRYGLYSVPPVLAVTADTYAQLQDHTLLPTILQRMEAVLTQSMKDGDA
KAAYETLRVYKLLHDKDRYMKGGARDVSNWVLKDWEHADSAAAFGGRASMAGHATALFSG
ERPVQSASLPNEALVRAVQDFLNSNTSTQRVYERAKAAMLREAPQEFTLVRAVGPQAGTV
FSRAGGLPLEKGVPGLFTYDGYHDVFSKRLPEFVGQAIDDDAWVMGRNASAVLDAAARKL
QNDPFLDDIRRQYLSEYAQHWESFLESIRTVGGSDTTGTSLGFDLSVLRQFAAPDSPLAR
LARAAARETTLSRPLVVRAQEEKGFLDKASDELNKQTSAIGRNLGIRAEERLEKEIVDNR
FAALREVVTGQPDIGAASAGATGAKPGLETISGLVNEFYTLLVVADTALTAGSLPPGGSE
VGSRLKLEAGKLPAPFREVLTALATSGGDKVALGSTGILRNQAQQQLDRIMGLMAMQVSE
PCKRGVEGRYPLAAVAQDASIEDFTLVFAASGAADEFFNKYLASYVDTSVRPWRYKDPNV
AQAVAGAEGVAGGVAPAPATPGPTLLGELLKLLAQSGPNLDAFYRAQQIRDLFFRDAGGK
KLAWKMDLRVLELEPSITDLIIDIDGQGQRYIHGPVQAFTVHWPGPRGGAMAEITANPRI
SGPTSTLLASGPWALFRLLEKGRIVNTATPGRLSVEYSFDGRKALIDINSGSQPNPLNSD
VLKGFRCPGRAA

BLAST