GenomeNet

>vsp:VS_1337 K11904 type VI secretion system secreted protein VgrG | (GenBank) Conserved hypothetical protein (A)
MLKKGFITFSNVHIFQHSDSDHVMMLQDAQSPYKKSDIGKLDMIEVPSGNNPLLDKWMPQ
GQFHGASIELTSYDYSQTKLVSSKQKKSSHKIANNTKLTKQFYPNLGITGGMEDLASNLV
KRRIEQLEQNYQTVEAEAQHDSFELGKWFSLSSHLDKDQLGDYLVTELYTSYSTENHCQT
RLTLLDTSTPNYPSLTDKAKIHGLQSAIVAGNTAGEINQDEQGRVRIQFHWDTQTSGDKT
SCYVRVAQMMAGNGYGAQFIPRVGQEVLVSFIDGDPDQPIITGSVYNSKNPPPYKEANST
KTGISTKLSGLANELYFDDKKDNELLYMHATKDFTKEIENNLTETIKGELIQKTTKQVNV
STEDNYTLNSDKAIAAKGKSISLEADDKIELKVGSSKITMSSSSISIEASNIDIKASSAL
NLEGMNVTSKATSANKISGVTTALEATSSNSIKGLSVAIKADTTLTAEGSLSAEFKSGLK
GTFNGGVLGELKGAIVKVN

BLAST