GenomeNet

>vsp:VS_1338 no KO assigned | (GenBank) Hypothetical protein (A)
MTDNFSPSASAIVAKDSKSNEHAVSDFAISEYLSKPFKIELTLISKNFSIDDQLGQKLSI
TRFINDTNNQAATRVFNGIVTQVQLLGMDSNLQYSSYRITLRPWFWLLIHTHSFRVYQNQ
STKDIVSDVLTQAGFSGSFKAGTMPSSKREYCVQYDESDFDFVTRLLAEEGVHYFFQRSY
FPTQRLRSRDDATGRSEPL

BLAST