GenomeNet

>vvm:VVMO6_03913 K11893 type VI secretion system protein ImpJ | (GenBank) uncharacterized protein ImpJ/VasE (A)
MSVYSPIVWSEGMFLRPQHFQQQERALSHEYKGLTRLVGCYARGIESFSLDKEQLKEGVV
SLTECVGIFSDMTFVNIPIKEQLPEPLKIDPGIENTLVQLVIPAEKSQGQNVSHSETSMV
TRYKVVDHTLTDSVSGDEEVLQLAALKCELKATNDNLPGYVSLPLVKIRHVGSEGQVILD
EEFVPPFLNVHHSSLLTRYLNNVLAMIKIRADAIASRLGQGKSASSSAVDFIMLQMLNRY
EANLRHLSKGSELHPHELATALLSLIGELSTFSSKNKRVPKLPEYQHSNLGSVFSEMNQI
LSQYLSVVLEQTATKMPLDIRQFGIRVTPLPDKSLLSLCQFVLAVKADVSADEIRKKLPG
QIKVGPAENIRDLINNQINGIAVSPLNVVPRQMPYAAGYVYFELVKQGAYWARLNESGGM
AFHVSGNYPGLEMELWSINQ

BLAST