GenomeNet

>xco:114157142 K04296 leukotriene B4 receptor 1 | (RefSeq) leukotriene B4 receptor 1-like (A)
MNFSLGSSMNTTTAVPFSPSPNNVSARIGTAILILAFLLGFPGNMFVVWSVLCRVKKRSV
TCLLVLNLAVADGFVLLSAPLFIRFLVAGRGWEFGSAACKLVHYLSSVNMYVSIYLICLM
SMDRWLAVTRPFMSQRMRTKRSLLLLLFGVWVLAFLLSLPMPFYRSIIKMHIRNSSISIC
MPYHWGSMCHPVFQYLFETVMGCLVPFSLISTCYSSVICRLQSAKFQRRGQGSRLILLII
VTFAIFWLPYHVVNIIEVACLLKNDNLGKPCSPSARPNVTAFAYFSSAVNPILYVFAGSS
HIRQAGLSFMGRLFEATNSESRTTSTIARSGRSGSSPDESAVLYSLSTKIGKPFKGKGKE
RSSSLAGKEANEPALKTLATVEQLE

BLAST