GenomeNet

>xne:XNC1_4047 K01872 alanyl-tRNA synthetase [EC:6.1.1.7] | (GenBank) conserved hypothetical protein (A)
MTGQLSLDAVVIDIFKYNDGYIVITDNSPFYPENYKWGDQKSDVGVIEFNNHILNIVKTY
TAAVIDGQIYIDQNIPDKLNAEDKLIPAHYLESLNGLEDKFILGENIKLSVDAETRHKIS
AAHSMAHFMSLALNKAANKYWNKGYETDSLGNFNLDKAAIFKSSISELKSIDIYRFGKSI
KKKGFDKSSFMENIDSTSEEINLILKNWLSIGSEIQVEYTSKNIEDLRLWKSTVENKPVV
IPCGGTHIKNIEEIKDVKVEISQGESDEYIVIITHCTLR

BLAST