GenomeNet

>xoy:AZ54_20810 K01028 3-oxoacid CoA-transferase subunit A [EC:2.8.3.5] | (GenBank) succinyl-CoA:3-ketoacid-CoA transferase (A)
MRNEVSGAASGKRYADAKTALDGVLADGQTLAVGGFGLCGIPEALIAALRDSGVAGLTVI
SNNAGVDGFGLGQLLATRQIRKMISSYVGENKEFERQYLAGELELEFNPQGTLAERLRAG
GAGIAAFYTATGYGTIVAEGKETREFDGKHYVLETALHADVALVKAWRADTAGNLVFRKT
ARNFNPACAMAGRVCIAEVEEIVELGVIDPDQVHLPGIYVDRLVLNATPEKRIEQRTVRE
GQQ

BLAST