GenomeNet

>xtr:101731867 K20216 dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48] | (RefSeq) dusp10; dual specificity protein phosphatase 10 (A)
MPPSPLDDRVIVALSRPVRPQVLNLCLDSSYFESSSILSDSHKSLLSTSVVCLNAANLTY
MPSSTSSARSLGCGCSSASCCTVASYDKDSQSQAVSSTTITSGVSGPSASSSANQMVNNN
ENSGALSSSGSPISGATKQFSNIKIIYPNDLAKKISKCTKTHLPNQGPVIIDCRPFMEYN
KSHIQGAVHINCSDKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDDNTNEPS
RVMPTQPLHTVLESLKREGKEPLVLKGGLSSFKQNHESLCDNSLQLQDCSDGGGASAVSI
TLPQSIPTTPDIENAELTPILPFLYLGNEHDAQDLETMQTRNISYIVNVTTHLPLYHYEK
GVFNYKRLPATDSNKQNLRQYFEEAFEFIDEAHQCGKALLIHCQAGVSRSATIVIAYLMK
HTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGITPRILTPKLVGVETVV

BLAST