GenomeNet

>yee:YE5303_05971 K06968 23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186] | (GenBank) conserved hypothetical protein (A)
MNNKIALYCRSGFEKECAAEITAKAAQLEIFGFARVKENSGYVLFECYQLEDADRLIREV
PFRELIFARQMMVVGELLKDLPPEDRVSPIVGMLTGVVEKAGELRVEVADTNESKELLKF
CRKLTVPLRNAMREQKILSARENPHRPVVHVFFIASGCCYVGYSYSNNNSPFYMGIPRLK
FPSDAPSRSTLKLEEAFHVFIPADEWEERLASGMHAVDLGACPGGWTYQLVQRSMMVQAI
DNGLMAQSLMDTGQVTHHRVDGFKYEPTRSNIYWLVCDMVEKPAKVTQLIIKWLVNGWCR
EAIFNLKLPMKKRFEVVSENLEMIDEQLKENGINAHIQAKQLYHDREEVTVHVRRIWSGV
PGRRDERF

BLAST