GenomeNet

>ypa:YPA_3408 K11911 type VI secretion system protein VasL | (GenBank) hypothetical protein (A)
MLWGFGAGVLCSLLVATAVYVTQFKPLQQQMTVLATQPESAALLWLNRPDVATYGEQLST
LENLSPLFVLNTADQSVAMARQRWPSDPSQVAESQRWARLVEARIGLAGTDSSYFQLQQR
LHALSEKLLEQERSRGSLTISYLKTAVYQMQTELNREIPLEELLRQLAVSADEHQPASPV
LIKQIDDRWNALLSRYHHLTQQTNSAR

BLAST