GenomeNet

>yph:YPC_4024 K11906 type VI secretion system protein VasD | (GenBank) putative lipoprotein (A)
MRSLFRVLPIFILTGCVLLSGCSWFSSSSEAALQKRRIDLQVVAAPLINPGPNGQAQPLK
VCIIELNKEGWSPPGLYQGTLCSGISVGGEVVSVTEYILAPTEVRQYSRDVPFEQERWWA
IAAEFQEMSNGKSLLTLKSDARADFNRVVLVDGKALSLKASTK

BLAST