GenomeNet

>ypi:YpsIP31758_0728 K11893 type VI secretion system protein ImpJ | (GenBank) conserved hypothetical protein (A)
MKIERPLWARGILVSPQQFQQQASWEAWTNECIAQMAVMHPWGVLQAVFEPDALAQGRLK
AARLHVRFPDGVLVDTECADVLPPTLTLAASLPAEASDATVMLAIPQLYANGGNCLQPDE
RGERPVRHRQAWRDVQNQFGDDKKQVAVMHHQLTLRLDTQENGDYQVCPVARLLRDAQGR
WTLDPGFIPPMLSLQASAWCGEQLELLMVQLRARLQRLMGMRRESNARMADFAVADVSLF
WLLNALNSAEPVLGNFQRYPQIHPERLYQELARLAGSLLTFSLEHEVTAIPVYQHEQLTR
VFPPLFALLNILLEASLPSRVVAIELVHEPRINQWRATLRDPRLREGADFYLSVRSSLPA
AQLQTQFPQLCKAGAPDEVGNVVNVALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAA
TQMMETGACVFYVPGTLGEIQLELFAVLRA

BLAST