GenomeNet

>ypp:YPDSF_3133 K11900 type VI secretion system protein ImpC | (GenBank) hypothetical protein (A)
MENMQKAQLNDTPDINVDLAENELDDILKRSFRPRTDEASATVRRAIGTLAAYANKGQVK
VNRDVVLTIESLVAEIDEKLSDQMNLILHHKEFQKLESAWRGLSYLVDNTDANETLKIRV
LNISQDELGKTLRRYRGSAWDQSPIFKQVYEHEYGQFGGEPFGCMIGDYEFDHSPQSVAL
LTELAKVAAAAHCPFITSSSPSIMQMNNWRELGNPRDIGKIFTTPEYAPWRRLRESNDSR
YLVLTLPRFLSRLPYGAKNHPIDDFAFEEVVSPHASEDFTWANAAYAMGVNINRAFNEYG
WCSRIRGIESGGSVEELPAYAFPSDEGGYELTCPTELAISDRRENELSNAGFLPLVYRKN
SDFAAFIGSCTLHAPANYDDPDATANARLSARLPYIFATCRFAHYLKCIVRDKIGSFRSR
DDMQLWLNDWVMNYVDGDPSISTEATKAKRPLAAAEVQVEDVEDDPGFYRAHFYLRPHYQ
LEGMTVSLRLVSKLPSNKESEKK

BLAST