GenomeNet

>ypz:YPZ3_0323 no KO assigned | (GenBank) hypothetical protein (A)
MNNTMNKSLWGRRSLLSLLIAGSLMLAGVNAHADDNDDNGTLFGISLPQVNDSNVGYGKS
ASGAVSDKLFYSLGGGSVISQPATRGNMQRLGMNLGWSSDLMCGNFDLKTTIGNQLNGVT
DGFKNLMGSVIQGATGAVGSLPAMAIQRANPGLYEMLTNGVLQGGVAFDKAQLNCQNLSK
RMMDMADSGGWSQAAAMEEAKSLINNGDADAVRSMNATEKVTGQSGQTWIGGQKRGGAGQ
PAIKPTHDLAAAGYNMMNALPVTSTSSVSGSSCTGGACAKYASSEEAAAAVVKVLGDSSL
RTCKDAAQCTSGEGSEQPGSTVAGTGFAPMLEEATKENNEQLAKLVNGAEKPTAANLAKL
KTGSLAVTAGVIKALQRDPDNAALVGRLASELAMADTIETAFIMRRMVTTGMSEPNAAVQ
KMAMEEGDRRIEALDREITALKNEMEMKREISRNAVLTIIDRENNRAETNPQRQSVDSPD
TKFNQLAVPESDQ

BLAST