GenomeNet

>ysi:BF17_02210 K00605 aminomethyltransferase [EC:2.1.2.10] | (GenBank) gcvT; glycine cleavage system protein T (A)
MAKQTPLYDQHVACGARMVDFHGWMMPLHYGSQIDEHHLVRQDAGMFDVSHMTIVDLHGS
RTREFLRYLLANDVAKLTQPGKALYTGMLNESGGVIDDLIVYFLSEDYFRLVVNSATRDK
DLAWIIQHAEPYQVEVTVRDDLALVAVQGPQAQQKVATLLTTEQQQAVAGMKPFFGIQTG
DLFIATTGYTGEAGYEIALPKQQVVAFWQQLLAAGVKPAGLGARDTLRLEAGMNLYGQEM
DERTSPLAANMGWTVAWQPEDRQFIGRTALERQRAKGTEQLVGLIMTEKGVLRNELPVYF
FDAAGNQHVGVITSGSFSPTLGFSIALARVPAGIGEHAVVQIRNREMPVRVTKPGFVRAG
KAIVL

BLAST