GenomeNet

>zga:ZOBELLIA_401 no KO assigned | (GenBank) Conserved hypothetical protein (A)
MKDFPENDIRQEVFNLDFDLKAETLLSYIEEDTQVDLSLSDFFKRRFSKDITRIEKDRYN
DDTLNVHLSRRSFYNVLPERFFHSTYISTPFVNTMVADYHGRKIEQENALKFFKPLETEF
FLHRVDIESAENEILTALGSPKLVDFLMDLWKIDERIPKRMAAKILKTMPFMYKIAGNIP
LLKKILENIIEEEILIEKDFATAGLPVTNEPWQLGVNMATSGKQKTFLPKYIFTMNNISR
PENIEDYLPDGKITAVVNFFLEHTLPHESDFEINFRLPKRKTRFIMTEDAYSGRLGISAT
I

BLAST