GenomeNet

>rs:NP_001004728 [NP_001004728] olfactory receptor 5A1 [Homo sapiens].
msitkawnsssvtmfillgftdhpelqallfvtflgiylttlawnlaliflirgdthlht
pmyfflsnlsfidicyssavapnmltdffweqktisfvgcaaqffffvgmglseclllta
maydryaaisspllyptimtqglctrmvvgayvggflssliqassifrlhfcgpniinhf
fcdlppvlalscsdtflsqvvnflvvvtvggtsflqllisygyivsavlkipsaegrwka
cntcashlmvvtllfgtalfvylrpsssyllgrdkvvsvfyslvipmlnpliyslrnkei
kdalwkvlerkkvfs

BLAST