GenomeNet

>rs:NP_001168844 [NP_001168844] putative leucine-rich repeat receptor-like protein kinase family protein precursor [Zea mays].
mptpplrgaglllriclflclslrprlassepdadkaallaflsgvgrgatararinwst
thlacsadgpgpgwtgvtcsadgarvvalhlpglglsgavppgtlgrltalqllslrsnd
lsgplpadllrlpaleglhlhrnafsgalpaalagltalqvldlsfnafdgavpgalanl
trlvaldlsnnslsgrvpdlglpalrflnlsnnrldgtvpasllrfpdaafagnsltrpa
paqappvvvapppglaappparrrprlseaailaiavggcvlgfavaallllafcnssre
grdeetvgggaaagkggekkgrespeskavigkagdgnrmvffeapslafdledllrasa
evlgkgafgtayravledattvvvkrlkevnagrrdfeqqmellgrirhdnvvelrayyy
skdekllvydyysrgsvsnmlhgkrgedrtpldwetrlkialgaargvahihtenngrfv
hgnikasnvfinkhergcvsdhglaslmnpvtvrsrslgycapevadtrkasqssdvysf
gvfvlelltgkspvqitggnggdvvhlvrwvqsvvreewtaevfdgellrypnieeemve
mlqvamacvsrsperrprmadvvrtieevrrsgsgtatgtgtrpsteastpataaeaaqs
raeeggssavaq

BLAST