GenomeNet

>rs:NP_033728 [NP_033728] angiotensin-converting enzyme isoform 2 precursor [Mus musculus].
mgqgwatpglpsflflllccghhllvlsqvatdhvtanqgitnqattrsqttthqatidq
ttqipnletdeakadrfveeydrtaqvllneyaeanwqyntnitiegskillekstevsn
htlkygtraktfdvsnfqnssikriikklqnldravlppkeleeynqilldmettyslsn
icytngtcmplepdltnmmatsrkyeellwawkswrdkvgrailpffpkyvefsnkiakl
ngytdagdswrslyesdnleqdleklyqelqplylnlhayvrrslhrhygseyinldgpi
pahllgnmwaqtwsniydlvapfpsapnidateamikqgwtprrifkeadnfftslgllp
vppefwnksmlekptdgrevvchpsawdfyngkdfrikqctsvnmedlviahhemghiqy
fmqykdlpvtfreganpgfheaigdimalsvstpkhlyslnllstegsgyeydinflmkm
aldkiafipfsylidqwrwrvfdgsitkenynqewwslrlkyqglcppvprsqgdfdpgs
kfhvpanvpyvryfvsfiiqfqfhealcraaghtgplhkcdiyqskeagklladamklgy
skpwpeamklitgqpnmsasammnyfkpltewlvtenrrhgetlgwpeynwapntaraeg
staesnrvnflglylepqqarvgqwvllflgvallvatvglahrlynirnhhslrrphrg
pqfgsevelrhs

BLAST