GenomeNet

>rs:NP_036676 [NP_036676] angiotensin-converting enzyme precursor [Rattus norvegicus].
mgaasgqrgrwplsppllmlslllllllppspapaldpglqpgnfsadeagaqlfadsyn
ssaevvmfqstaaswahdtniteenarlqeeaalinqefaevwgkkakelyesiwqnftd
qklrriigsvqtlgpanlpltqrlqynsllsnmsriystgkvcfpnktatcwsldpeltn
ilassrnyakvlfawegwhdavgiplkplyqdftalsneayrqdgfsdtgaywrswyesp
sfeeslehlyhqveplylnlhafvrralhrrygdkyinlrgpipahllgdmwaqsweniy
dmvvpfpdkpnldvtstmvqkgwnathmfrvaeefftslglspmppefwaesmlekpadg
revvchasawdfynrkdfrikqctrvtmdqlstvhhemghvqyylqykdlhvslrrganp
gfheaigdvlalsvstpahlhkiglldrvandiesdinyllkmalekiaflpfgylvdqw
rwgvfsgrtppsrynydwwylrtkyqgicppvarnethfdagakfhipsvtpyiryfvsf
vlqfqfhqalckeaghqgplhqcdiyqstkagaklqqvlqagcsrpwqevlkdlvgsdal
dasalmeyfqpvsqwlqeqnqrngevlgwpeyqwrpplpdnypegidletdeakanrfve
eydrtakvlwneyaeanwhyntnitiegskillqknkevsnhtlkygtwaktfdvsnfqn
stikriikkvqnvdravlppneleeynqilldmettysvanvcytngtclslepdltnim
atsrkyeellwvwkswrdkvgrailpffpkyvdfsnkiaklngysdagdswrssyesddl
eqdleklyqelqplylnlhayvrrslhrhygseyinldgpipahllgnmwaqtwsniydl
vapfpsapsidateamikqgwtprrifkeadnfftslgllpvppefwnksmlekptdgre
vvchasawdfyngkdfrikqctsvnmeelviahhemghiqyfmqykdlpvtfreganpgf
heaigdvlalsvstpkhlhslnllssegsgyehdinflmkmaldkiafipfsylidqwrw
rvfdgsitkenynqewwslrlkyqglcppvprsqgdfdpgskfhvpanvpyiryfisfii
qfqfhealcraaghtgplykcdiyqskeagklladamklgyskqwpeamkiitgqpnmsa
saimnyfkpltewlvtenrrhgetlgwpeytwtpntaraegslpessrvnflgmylepqq
arvgqwvllflgvallvatvglahrlynihnhhslrrphrgpqfgsevelrhs

BLAST