GenomeNet

>rs:NP_250624 [NP_250624] hypothetical protein PA1934 [Pseudomonas aeruginosa PAO1].
mknamaltlagllaapslgfaaapdavmvfarqgdkgsvsvgdkhfrtqafkvrlvnaak
seislknsclvaqsaagqsfrldtvdeeltadtlkpgasvegdaifaseddavygaslvr
lsdrck

BLAST