GenomeNet

>rs:NP_308063 [NP_308063] carbamoyl-phosphate synthase large subunit [Escherichia coli O157:H7 str. Sakai].
mpkrtdiksililgagpivigqacefdysgaqackalreegyrvilvnsnpatimtdpem
adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
ltkirrelkdagaeriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
itglnaeflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
vigtspdaidraedrerfqhavdrlklkqpanatvtaiemavekakeigyplvvrpsyvl
ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik

BLAST